"event" : "RevokeSolutionAction", if ( neededkeys[count] == key ) { { }, 1. "action" : "rerender" "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", { "actions" : [ { "truncateBodyRetainsHtml" : "false", } { "context" : "", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { "event" : "editProductMessage", LITHIUM.AjaxSupport.useTickets = false; "message" : "1594392", //var height = $(window).scrollTop(); { "action" : "rerender" } "kudosLinksDisabled" : "false", ] "context" : "", "truncateBody" : "true", } "linkDisabled" : "false" "message" : "1594351", LITHIUM.AjaxSupport.ComponentEvents.set({ { { }, Bis zu 15 Monate Pause gehen für CallYa Digital in Ordnung. { "actions" : [ element.find('li').removeClass('active'); "event" : "removeThreadUserEmailSubscription", "event" : "MessagesWidgetAnswerForm", }, LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "action" : "rerender" }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }, "action" : "pulsate" { "context" : "envParam:entity", } { LITHIUM.AjaxSupport.useTickets = false; }, ] { }); "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "actions" : [ "useSubjectIcons" : "true", "dialogKey" : "dialogKey" } "event" : "AcceptSolutionAction", "initiatorBinding" : true, }, "event" : "MessagesWidgetCommentForm", "event" : "expandMessage", LITHIUM.Dialog.options['-1256621403'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "componentId" : "kudos.widget.button", "event" : "MessagesWidgetAnswerForm", "actions" : [ { { }, "initiatorBinding" : true, "event" : "RevokeSolutionAction", ;(function($) { { }, }, "truncateBodyRetainsHtml" : "false", { ] } "event" : "MessagesWidgetEditAction", "eventActions" : [ }, "context" : "", { { "event" : "ProductAnswer", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1594276 .lia-rating-control-passive', '#form_2'); ] { { { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "eventActions" : [ }, ] "event" : "markAsSpamWithoutRedirect", }, "event" : "AcceptSolutionAction", Hier mehr erfahren. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_2.lineardisplaymessageviewwrapper_0:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/43476","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8j5AS5rPtCACJHP1gVud1LdY4Oyhv5b41ekID-1UxHQ. "event" : "MessagesWidgetEditAnswerForm", { }, }, "context" : "", "action" : "rerender" { } "action" : "rerender" "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", window.location = "https://forum.vodafone.de/t5/Archiv-CallYa/Tarif-K%C3%BCndigen/td-p/1594208" + "/page/" + 1; "context" : "", "actions" : [ "action" : "rerender" ] LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] { "context" : "", } "context" : "", "revokeMode" : "true", ;(function($) { { { LITHIUM.AjaxSupport.ComponentEvents.set({ ] "event" : "MessagesWidgetCommentForm", ] "displayStyle" : "horizontal", "context" : "envParam:feedbackData", { "actions" : [ "action" : "addClassName" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" { { "event" : "QuickReply", } "message" : "1594276", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "actions" : [ }, "event" : "unapproveMessage", Deinen Vodafone Handyvertrag (Prepaid und Callya), sowie Festnetz, kannst du ganz einfach per E-Mail, per Fax oder per Post kündigen. "action" : "pulsate" Callya Flex ist dabei ein Prepaid Tarif und basiert auf der bekannten Callya Reihe. { "context" : "envParam:quiltName", "action" : "rerender" }, count++; } "action" : "rerender" "actions" : [ "componentId" : "kudos.widget.button", "context" : "envParam:quiltName", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "lia-deleted-state", "context" : "", "action" : "rerender" return; "actions" : [ "actions" : [ }, }, "action" : "rerender" } "action" : "rerender" { { "action" : "rerender" }, "context" : "envParam:quiltName,expandedQuiltName", { }, "action" : "rerender" } } "initiatorDataMatcher" : "data-lia-kudos-id" "initiatorBinding" : true, "context" : "", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "buttonDialogCloseAlt" : "Schließen", "disallowZeroCount" : "false", "context" : "envParam:quiltName", "event" : "AcceptSolutionAction", ] ] "context" : "", ] }); }, "quiltName" : "ForumMessage", "context" : "", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "disableLinks" : "false", "event" : "MessagesWidgetMessageEdit", "action" : "rerender" "eventActions" : [ }, $(document).ready(function(){ "event" : "expandMessage", { "selector" : "#messageview", } { "kudosable" : "true", ] "truncateBodyRetainsHtml" : "false", "linkDisabled" : "false" "action" : "pulsate" }, count++; ] if ( neededkeys[count] == key ) { "event" : "QuickReply", "context" : "envParam:quiltName,expandedQuiltName", }, } }); "event" : "kudoEntity", }, { "context" : "", } ] ] "event" : "expandMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", "}); $('#vodafone-community-header .lia-search-input-wrapper').hide(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "messageViewOptions" : "1111110111111111111110111110100101011101" } "actions" : [ "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "deleteMessage", "actions" : [ } }); "context" : "", } } "actions" : [ } "selector" : "#kudosButtonV2_2", Der ... Telekom-Netz) für 20 € im Monat (2 Optionen kündigen) – noch zu haben! "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1594351 .lia-rating-control-passive', '#form_4'); "displayStyle" : "horizontal", { ] LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "context" : "envParam:quiltName", "kudosable" : "true", "context" : "envParam:entity", } ] ] LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); // We're good so far. ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); }, "}); "event" : "deleteMessage", ] "eventActions" : [ "context" : "", "action" : "rerender" { ] $(document).keydown(function(e) { "event" : "RevokeSolutionAction", ] "actions" : [ "actions" : [ "action" : "rerender" "}); ] ] }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/43476","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iup-Ydgp9T4HgrjOzMHgl45mYX81FTUMbNqb42VxyBE. { { } "initiatorBinding" : true, "selector" : "#messageview_5", "actions" : [ "event" : "unapproveMessage", "action" : "rerender" "revokeMode" : "true", "eventActions" : [ { Unsere CallYa-Karten sind unbefristet gültig. { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "actions" : [ "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); { "event" : "MessagesWidgetEditAction", "context" : "envParam:quiltName", "context" : "envParam:feedbackData", "event" : "deleteMessage", { "action" : "addClassName" "useCountToKudo" : "false", { "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", { "forceSearchRequestParameterForBlurbBuilder" : "false", }, "context" : "envParam:quiltName,expandedQuiltName", ] "context" : "envParam:quiltName", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", "event" : "deleteMessage", { } "action" : "pulsate" "context" : "", }, "action" : "rerender" "useCountToKudo" : "false", "actions" : [ watching = false; ] }, "context" : "envParam:selectedMessage", "action" : "rerender" "disallowZeroCount" : "false", } "includeRepliesModerationState" : "false", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1594208}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1594286}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1594259}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1594276}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1594286}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1594351}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1594392}}]); .attr('aria-expanded','true') } { "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "context" : "", }, "forceSearchRequestParameterForBlurbBuilder" : "false", ] "actions" : [ { "context" : "", "kudosLinksDisabled" : "false", ] "actions" : [ }); "context" : "", "action" : "addClassName" "action" : "rerender" "action" : "rerender" "action" : "rerender" "actions" : [ "event" : "removeThreadUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" ] "parameters" : { { } } }, Bist du sicher, dass du fortfahren möchtest? ] "action" : "rerender" "selector" : "#messageview_5", "action" : "rerender" { ] "context" : "", { element.siblings('li').children('ul').slideUp(); ] { "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ ] ] "initiatorBinding" : true, { Bist du sicher, dass du fortfahren möchtest? { }, ], { }, "actions" : [ "action" : "rerender" { }, "action" : "rerender" "event" : "RevokeSolutionAction", }, }, if ( count == neededkeys.length ) { } "event" : "approveMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "action" : "rerender" var count = 0; { ] "actions" : [ "}); }, } "action" : "pulsate" } { "event" : "markAsSpamWithoutRedirect", "actions" : [ "event" : "deleteMessage", "event" : "removeThreadUserEmailSubscription", } { "event" : "approveMessage", "action" : "rerender" "event" : "AcceptSolutionAction", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetCommentForm", "event" : "removeMessageUserEmailSubscription", } "kudosLinksDisabled" : "false", ] ] "actions" : [ LITHIUM.Auth.CHECK_SESSION_TOKEN = 'KwokuPA_O4cMXe9SW4IUo65ZlsiQ6xrZiI1wdp4eiwQ. .attr('aria-expanded','true'); } else { "context" : "", ] "displayStyle" : "horizontal", "event" : "MessagesWidgetCommentForm", "action" : "rerender" "action" : "rerender" }, "eventActions" : [ "action" : "rerender" { } "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "useSubjectIcons" : "true", Bist du sicher, dass du fortfahren möchtest? window.location.replace('/t5/user/userloginpage'); "messageViewOptions" : "1111110111111111111110111110100101001101" ] "actions" : [ // console.log(key); "truncateBodyRetainsHtml" : "false", "truncateBody" : "true", 15 Jul. } ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1594286 .lia-rating-control-passive', '#form_3'); }, "displaySubject" : "true", "context" : "envParam:quiltName", }, // --> }, "event" : "addThreadUserEmailSubscription", "initiatorBinding" : true, } { '; "context" : "", { "initiatorBinding" : true, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } LITHIUM.Dialog.options['1007134317'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "lia-deleted-state", "componentId" : "forums.widget.message-view", "actions" : [ { element.siblings('li').removeClass('active'); "context" : "envParam:quiltName,expandedQuiltName", "useSimpleView" : "false", "showCountOnly" : "false", "event" : "removeMessageUserEmailSubscription", "actions" : [ Sollten Sie innerhalb der ersten Vertragsmonate kündigen, können die Rabatte entfallen. // console.log(key); // If watching, pay attention to key presses, looking for right sequence. { LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:quiltName", }, "actions" : [ "event" : "markAsSpamWithoutRedirect", LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "pulsate" }, "action" : "pulsate" "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:feedbackData", "parameters" : { "event" : "removeThreadUserEmailSubscription", }, Vodafone CallYa-Tarif kündigen – so gehst du vor. } Sie entscheiden über den Betrag. "action" : "rerender" "revokeMode" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); "event" : "QuickReply", "event" : "ProductMessageEdit", { "dialogContentCssClass" : "lia-panel-dialog-content", } Bist du sicher, dass du fortfahren möchtest? "event" : "deleteMessage", { LITHIUM.AjaxSupport.ComponentEvents.set({ ] ] { } { { // We're good so far. }, LITHIUM.Loader.runJsAttached(); ] "actions" : [ { "disallowZeroCount" : "false", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "event" : "markAsSpamWithoutRedirect", ] "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/43476","ajaxErrorEventName":"LITHIUM:ajaxError","token":"T4MWu5wPNYKgk2pYiozaLv9ja7tLBwYcn2a7-5DuFZ0. "disableKudosForAnonUser" : "false", "useTruncatedSubject" : "true", ] "context" : "", Bist du sicher, dass du fortfahren möchtest? "disableLabelLinks" : "false", { "actions" : [ "context" : "envParam:selectedMessage", } "actions" : [ { "actions" : [ "}); "action" : "pulsate"